Lineage for d3b82e5 (3b82 E:726-842)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909683Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 1909684Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 1909685Protein Elongation factor 2 (eEF-2) [82677] (2 species)
  7. 1909686Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
    Uniprot P32324
  8. 1909694Domain d3b82e5: 3b82 E:726-842 [199059]
    Other proteins in same PDB: d3b82a1, d3b82a2, d3b82a4, d3b82b_, d3b82c1, d3b82c2, d3b82c4, d3b82d_, d3b82e1, d3b82e2, d3b82e4, d3b82f_
    automated match to d1n0vc5
    protein/RNA complex; complexed with nad

Details for d3b82e5

PDB Entry: 3b82 (more details), 2.35 Å

PDB Description: structure of the eef2-exoa(e546h)-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d3b82e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b82e5 d.58.11.1 (E:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d3b82e5:

Click to download the PDB-style file with coordinates for d3b82e5.
(The format of our PDB-style files is described here.)

Timeline for d3b82e5: