| Class b: All beta proteins [48724] (174 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (10 proteins) |
| Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (16 PDB entries) Uniprot P32324 |
| Domain d3b82e2: 3b82 E:344-481 [199056] Other proteins in same PDB: d3b82a1, d3b82a3, d3b82a4, d3b82a5, d3b82b_, d3b82c1, d3b82c3, d3b82c4, d3b82c5, d3b82d_, d3b82e1, d3b82e3, d3b82e4, d3b82e5, d3b82f_ automated match to d1n0vc1 protein/RNA complex; complexed with nad |
PDB Entry: 3b82 (more details), 2.35 Å
SCOPe Domain Sequences for d3b82e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b82e2 b.43.3.1 (E:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm
Timeline for d3b82e2:
View in 3DDomains from same chain: (mouse over for more information) d3b82e1, d3b82e3, d3b82e4, d3b82e5 |