![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor 2 (eEF-2) [82677] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) Uniprot P32324 |
![]() | Domain d3b82c5: 3b82 C:726-842 [199054] Other proteins in same PDB: d3b82a1, d3b82a2, d3b82a4, d3b82b1, d3b82b2, d3b82c1, d3b82c2, d3b82c4, d3b82d1, d3b82d2, d3b82e1, d3b82e2, d3b82e4, d3b82f1, d3b82f2 automated match to d1n0vc5 protein/RNA complex; complexed with nad |
PDB Entry: 3b82 (more details), 2.35 Å
SCOPe Domain Sequences for d3b82c5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b82c5 d.58.11.1 (C:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d3b82c5:
![]() Domains from same chain: (mouse over for more information) d3b82c1, d3b82c2, d3b82c3, d3b82c4 |