| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
| Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (16 PDB entries) Uniprot P32324 |
| Domain d3b78e5: 3b78 E:726-842 [199044] Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a4, d3b78b_, d3b78c1, d3b78c2, d3b78c4, d3b78d_, d3b78e1, d3b78e2, d3b78e4, d3b78f_ automated match to d1n0vc5 protein/RNA complex; complexed with nad |
PDB Entry: 3b78 (more details), 2.5 Å
SCOPe Domain Sequences for d3b78e5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b78e5 d.58.11.1 (E:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d3b78e5:
View in 3DDomains from same chain: (mouse over for more information) d3b78e1, d3b78e2, d3b78e3, d3b78e4 |