| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
| Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries) Uniprot P32324 |
| Domain d3b78c4: 3b78 C:561-725 [199038] Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a3, d3b78a5, d3b78b_, d3b78c1, d3b78c2, d3b78c3, d3b78c5, d3b78d_, d3b78e1, d3b78e2, d3b78e3, d3b78e5, d3b78f_ automated match to d1n0vc3 protein/RNA complex; complexed with nad |
PDB Entry: 3b78 (more details), 2.5 Å
SCOPe Domain Sequences for d3b78c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b78c4 d.14.1.1 (C:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d3b78c4:
View in 3DDomains from same chain: (mouse over for more information) d3b78c1, d3b78c2, d3b78c3, d3b78c5 |