Lineage for d3b78c2 (3b78 C:344-481)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062653Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species)
  7. 2062654Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 2062660Domain d3b78c2: 3b78 C:344-481 [199036]
    Other proteins in same PDB: d3b78a1, d3b78a3, d3b78a4, d3b78a5, d3b78b1, d3b78b2, d3b78c1, d3b78c3, d3b78c4, d3b78c5, d3b78d1, d3b78d2, d3b78e1, d3b78e3, d3b78e4, d3b78e5, d3b78f1, d3b78f2
    automated match to d1n0vc1
    protein/RNA complex; complexed with nad

Details for d3b78c2

PDB Entry: 3b78 (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(r551h)-nad+ complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d3b78c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b78c2 b.43.3.1 (C:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d3b78c2:

Click to download the PDB-style file with coordinates for d3b78c2.
(The format of our PDB-style files is described here.)

Timeline for d3b78c2: