Lineage for d3b78a5 (3b78 A:726-842)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416679Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 1416680Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 1416681Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 1416682Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (16 PDB entries)
    Uniprot P32324
  8. 1416692Domain d3b78a5: 3b78 A:726-842 [199034]
    Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a4, d3b78b_, d3b78c1, d3b78c2, d3b78c4, d3b78d_, d3b78e1, d3b78e2, d3b78e4, d3b78f_
    automated match to d1n0vc5
    protein/RNA complex; complexed with nad

Details for d3b78a5

PDB Entry: 3b78 (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(r551h)-nad+ complex
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d3b78a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b78a5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d3b78a5:

Click to download the PDB-style file with coordinates for d3b78a5.
(The format of our PDB-style files is described here.)

Timeline for d3b78a5: