Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
Domain d3b78a2: 3b78 A:344-481 [199031] Other proteins in same PDB: d3b78a1, d3b78a3, d3b78a4, d3b78a5, d3b78b_, d3b78c1, d3b78c3, d3b78c4, d3b78c5, d3b78d_, d3b78e1, d3b78e3, d3b78e4, d3b78e5, d3b78f_ automated match to d1n0vc1 protein/RNA complex; complexed with nad |
PDB Entry: 3b78 (more details), 2.5 Å
SCOPe Domain Sequences for d3b78a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b78a2 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d3b78a2:
View in 3D Domains from same chain: (mouse over for more information) d3b78a1, d3b78a3, d3b78a4, d3b78a5 |