Lineage for d3b2ux2 (3b2u X:108-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368604Domain d3b2ux2: 3b2u X:108-213 [199024]
    Other proteins in same PDB: d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2uc3, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2uf3, d3b2uh1, d3b2uh2, d3b2uh3, d3b2ui1, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uj3, d3b2um1, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2un3, d3b2up1, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2uq3, d3b2us1, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2ut3, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2uw3
    automated match to d1f3dj2
    complexed with bma, man, nag, so4

Details for d3b2ux2

PDB Entry: 3b2u (more details), 2.58 Å

PDB Description: crystal structure of isolated domain iii of the extracellular region of the epidermal growth factor receptor in complex with the fab fragment of imc-11f8
PDB Compounds: (X:) IMC-11F8 FAB Light chain

SCOPe Domain Sequences for d3b2ux2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2ux2 b.1.1.0 (X:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

SCOPe Domain Coordinates for d3b2ux2:

Click to download the PDB-style file with coordinates for d3b2ux2.
(The format of our PDB-style files is described here.)

Timeline for d3b2ux2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b2ux1
View in 3D
Domains from other chains:
(mouse over for more information)
d3b2ua1, d3b2ua2, d3b2ua3, d3b2ub1, d3b2ub2, d3b2ub3, d3b2uc1, d3b2uc2, d3b2uc3, d3b2ud1, d3b2ud2, d3b2ue1, d3b2ue2, d3b2ue3, d3b2uf1, d3b2uf2, d3b2uf3, d3b2ug1, d3b2ug2, d3b2uh1, d3b2uh2, d3b2uh3, d3b2ui1, d3b2ui2, d3b2ui3, d3b2uj1, d3b2uj2, d3b2uj3, d3b2uk1, d3b2uk2, d3b2ul1, d3b2ul2, d3b2um1, d3b2um2, d3b2um3, d3b2un1, d3b2un2, d3b2un3, d3b2uo1, d3b2uo2, d3b2up1, d3b2up2, d3b2up3, d3b2uq1, d3b2uq2, d3b2uq3, d3b2ur1, d3b2ur2, d3b2us1, d3b2us2, d3b2us3, d3b2ut1, d3b2ut2, d3b2ut3, d3b2uu1, d3b2uu2, d3b2uv1, d3b2uv2, d3b2uv3, d3b2uw1, d3b2uw2, d3b2uw3