SCOP 1.65: Domain d1tetl1: 1tet L:1-107

Lineage for d1tetl1 (1tet L:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)

8. Domain d1tetl1: 1tet L:1-107 [19902]
   Other proteins in same PDB: d1teth1, d1teth2, d1tetl2
   part of Fab TE33
   complexed with cit

Details for d1tetl1

PDB Entry: 1tet, 2.3 Å

PDB Description: crystal structure of an anticholera toxin peptide complex at 2.3 angstroms

SCOP Domain Sequences for d1tetl1:

Sequence; same for both SEQRES and ATOM records:

>d1tetl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqtplslpvslgdqasisckssqsivhssgntyfewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipftfgsgtkleik

Timeline for d1tetl1:

• d1tetl1 first appeared (with stable ids) in SCOP 1.55
  
• d1tetl1 appears in SCOP 1.63
  
• d1tetl1 appears in SCOP 1.67
  
• d1tetl1 appears in the current release, SCOPe 2.08