SCOPe 2.07: Domain d1cbvh1: 1cbv H:1-122

Lineage for d1cbvh1 (1cbv H:1-122)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d1cbvh1: 1cbv H:1-122 [19901]
   Other proteins in same PDB: d1cbvh2, d1cbvl1, d1cbvl2
   part of Fab BV04-01
   protein/DNA complex

Details for d1cbvh1

PDB Entry: 1cbv, 2.66 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

PDB Compounds: (H:) protein (fab (bv04-01) autoantibody-heavy chain)

SCOPe Domain Sequences for d1cbvh1:

Sequence; same for both SEQRES and ATOM records:

>d1cbvh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evqpvetggglvqpkgslklscaasgfsfntnamnwvrqapgkglewvarirsksnnyat
yyadsvkdrftisrddsqnmlylqmnnlktedtamyycvrdqtgtawfaywgqgtlvtvs
aa

Timeline for d1cbvh1:

• d1cbvh1 first appeared (with stable ids) in SCOP 1.55
  
• d1cbvh1 appears in SCOPe 2.06
  
• d1cbvh1 appears in the current release, SCOPe 2.08