Lineage for d3b0wa_ (3b0w A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502431Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1502432Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1503538Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1503539Protein automated matches [191142] (5 species)
    not a true protein
  7. 1503547Species Human (Homo sapiens) [TaxId:9606] [189274] (8 PDB entries)
  8. 1503551Domain d3b0wa_: 3b0w A: [199003]
    automated match to d3b0wb_
    complexed with dgx

Details for d3b0wa_

PDB Entry: 3b0w (more details), 2.2 Å

PDB Description: crystal structure of the orphan nuclear receptor ror(gamma)t ligand- binding domain in complex with digoxin
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d3b0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b0wa_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqh

SCOPe Domain Coordinates for d3b0wa_:

Click to download the PDB-style file with coordinates for d3b0wa_.
(The format of our PDB-style files is described here.)

Timeline for d3b0wa_: