SCOP 1.73: Domain d1nbvl1: 1nbv L:1-112

Lineage for d1nbvl1 (1nbv L:1-112)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1nbvl1: 1nbv L:1-112 [19898]
   Other proteins in same PDB: d1nbvh1, d1nbvh2, d1nbvl2
   part of Fab BV04-01

Details for d1nbvl1

PDB Entry: 1nbv, 2 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

PDB Compounds: (L:) igg2b-kappa bv04-01 fab (light chain)

SCOP Domain Sequences for d1nbvl1:

Sequence; same for both SEQRES and ATOM records:

>d1nbvl1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgagtklelk

Timeline for d1nbvl1:

• d1nbvl1 first appeared (with stable ids) in SCOP 1.55
  
• d1nbvl1 appears in SCOP 1.71
  
• d1nbvl1 appears in SCOP 1.75
  
• d1nbvl1 appears in the current release, SCOPe 2.08