Lineage for d1mfdh1 (1mfd H:251-367)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782204Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E
    SQ NA # humanized antibody
    Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor
    Uniprot P01750 20-116 #
    HV06_MOUSE Ig heavy chain V region 102 precursor
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 782256Domain d1mfdh1: 1mfd H:251-367 [19897]
    Other proteins in same PDB: d1mfdh2, d1mfdl1, d1mfdl2
    part of Fab SE155-4
    complexed with abe, gal, mma

Details for d1mfdh1

PDB Entry: 1mfd (more details), 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure
PDB Compounds: (H:) igg1-lambda se155-4 fab (heavy chain)

SCOP Domain Sequences for d1mfdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfdh1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

SCOP Domain Coordinates for d1mfdh1:

Click to download the PDB-style file with coordinates for d1mfdh1.
(The format of our PDB-style files is described here.)

Timeline for d1mfdh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfdh2