SCOP 1.55: Domain d1mfdh1: 1mfd H:251-367

Lineage for d1mfdh1 (1mfd H:251-367)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)

8. Domain d1mfdh1: 1mfd H:251-367 [19897]
   Other proteins in same PDB: d1mfdh2, d1mfdl2

Details for d1mfdh1

PDB Entry: 1mfd, 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

SCOP Domain Sequences for d1mfdh1:

Sequence; same for both SEQRES and ATOM records:

>d1mfdh1 b.1.1.1 (H:251-367) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

Timeline for d1mfdh1:

• d1mfdh1 appears in SCOP 1.57
  
• d1mfdh1 appears in the current release, SCOPe 2.08