SCOPe 2.03: Domain d3axmx_: 3axm X:

Lineage for d3axmx_ (3axm X:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (5 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [195635] (2 PDB entries)

8. Domain d3axmx_: 3axm X: [198968]
   Other proteins in same PDB: d3axma1, d3axma2, d3axmb1, d3axmb2, d3axmc1, d3axmc2, d3axmd1, d3axmd2, d3axme1, d3axme2, d3axmf1, d3axmf2, d3axmg1, d3axmg2, d3axmh1, d3axmh2
   automated match to d3axmz_
   complexed with 6pg, mg

Details for d3axmx_

PDB Entry: 3axm, 1.65 Å

PDB Description: Structure of rice Rubisco in complex with 6PG

PDB Compounds: (X:) Ribulose bisphosphate carboxylase small chain, chloroplastic

SCOPe Domain Sequences for d3axmx_:

Sequence; same for both SEQRES and ATOM records:

>d3axmx_ d.73.1.1 (X:) automated matches {Oryza sativa [TaxId: 39947]}
xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykp
pgc

Timeline for d3axmx_:

• d3axmx_ is new in SCOPe 2.03-stable
  
• d3axmx_ appears in SCOPe 2.04
  
• d3axmx_ appears in the current release, SCOPe 2.08