SCOPe 2.02: Domain d1mfdl1: 1mfd L:1-111

Lineage for d1mfdl1 (1mfd L:1-111)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)

8. Domain d1mfdl1: 1mfd L:1-111 [19896]
   Other proteins in same PDB: d1mfdh1, d1mfdh2, d1mfdl2
   part of Fab SE155-4

Details for d1mfdl1

PDB Entry: 1mfd, 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOPe Domain Sequences for d1mfdl1:

Sequence; same for both SEQRES and ATOM records:

>d1mfdl1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

Timeline for d1mfdl1:

• d1mfdl1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfdl1 appears in SCOPe 2.01
  
• d1mfdl1 appears in SCOPe 2.03
  
• d1mfdl1 appears in the current release, SCOPe 2.08