Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries) |
Domain d1mfdl1: 1mfd L:1-111 [19896] Other proteins in same PDB: d1mfdh2, d1mfdl2 |
PDB Entry: 1mfd (more details), 2.1 Å
SCOP Domain Sequences for d1mfdl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfdl1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain} qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq
Timeline for d1mfdl1: