Lineage for d1mfdl1 (1mfd L:1-111)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7848Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)
  8. 7858Domain d1mfdl1: 1mfd L:1-111 [19896]
    Other proteins in same PDB: d1mfdh2, d1mfdl2

Details for d1mfdl1

PDB Entry: 1mfd (more details), 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

SCOP Domain Sequences for d1mfdl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfdl1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

SCOP Domain Coordinates for d1mfdl1:

Click to download the PDB-style file with coordinates for d1mfdl1.
(The format of our PDB-style files is described here.)

Timeline for d1mfdl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfdl2