Lineage for d3axma1 (3axm A:12-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952876Species Rice (Oryza sativa) [TaxId:4530] [117976] (5 PDB entries)
    Uniprot P12089
  8. 2952879Domain d3axma1: 3axm A:12-150 [198950]
    Other proteins in same PDB: d3axma2, d3axmb2, d3axmc2, d3axmd2, d3axme2, d3axmf2, d3axmg2, d3axmh2, d3axms_, d3axmt_, d3axmu_, d3axmv_, d3axmw_, d3axmx_, d3axmy_, d3axmz_
    automated match to d1wdda2
    complexed with 6pg, mg

Details for d3axma1

PDB Entry: 3axm (more details), 1.65 Å

PDB Description: Structure of rice Rubisco in complex with 6PG
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d3axma1:

Sequence, based on SEQRES records: (download)

>d3axma1 d.58.9.1 (A:12-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
gfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripptysktfqg

Sequence, based on observed residues (ATOM records): (download)

>d3axma1 d.58.9.1 (A:12-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
gfkagvtyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdglts
ldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrle
dlripptysktfqg

SCOPe Domain Coordinates for d3axma1:

Click to download the PDB-style file with coordinates for d3axma1.
(The format of our PDB-style files is described here.)

Timeline for d3axma1: