Lineage for d1mfch1 (1mfc H:251-367)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7848Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)
  8. 7853Domain d1mfch1: 1mfc H:251-367 [19895]
    Other proteins in same PDB: d1mfch2, d1mfcl2

Details for d1mfch1

PDB Entry: 1mfc (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfch1 b.1.1.1 (H:251-367) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

SCOP Domain Coordinates for d1mfch1:

Click to download the PDB-style file with coordinates for d1mfch1.
(The format of our PDB-style files is described here.)

Timeline for d1mfch1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfch2