Lineage for d1mfcl1 (1mfc L:1-111)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289510Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1289604Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)
  8. 1289610Domain d1mfcl1: 1mfc L:1-111 [19894]
    Other proteins in same PDB: d1mfch1, d1mfch2, d1mfcl2
    part of Fab SE155-4

Details for d1mfcl1

PDB Entry: 1mfc (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOPe Domain Sequences for d1mfcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfcl1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

SCOPe Domain Coordinates for d1mfcl1:

Click to download the PDB-style file with coordinates for d1mfcl1.
(The format of our PDB-style files is described here.)

Timeline for d1mfcl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfcl2