Lineage for d3asom_ (3aso M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025475Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 3025476Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 3025477Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025478Species Cow (Bos taurus) [TaxId:9913] [81428] (33 PDB entries)
  8. 3025490Domain d3asom_: 3aso M: [198934]
    Other proteins in same PDB: d3asoa_, d3asob1, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asok_, d3asol_, d3ason_, d3asoo1, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_
    automated match to d1v54m_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asom_

PDB Entry: 3aso (more details), 2.3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
PDB Compounds: (M:) Cytochrome c oxidase subunit 8B

SCOPe Domain Sequences for d3asom_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asom_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d3asom_:

Click to download the PDB-style file with coordinates for d3asom_.
(The format of our PDB-style files is described here.)

Timeline for d3asom_: