| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) ![]() automatically mapped to Pfam PF05392 |
| Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81420] (33 PDB entries) |
| Domain d3asok_: 3aso K: [198932] Other proteins in same PDB: d3asoa_, d3asob1, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asol_, d3asom_, d3ason_, d3asoo1, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_ automated match to d1v54k_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3aso (more details), 2.3 Å
SCOPe Domain Sequences for d3asok_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asok_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d3asok_:
View in 3DDomains from other chains: (mouse over for more information) d3asoa_, d3asob1, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asol_, d3asom_, d3ason_, d3asoo1, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_ |