SCOPe 2.03: Domain d3arfd2: 3arf D:119-247

Lineage for d3arfd2 (3arf D:119-247)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
Domain d3arfd2: 3arf D:119-247 [198923]
Other proteins in same PDB: d3arfa1, d3arfa2, d3arfb_, d3arfc1, d3arfd1
automated match to d1ktke2
complexed with db3

Details for d3arfd2

PDB Entry: 3arf (more details), 2.9 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-c20:2

PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3arfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arfd2 b.1.1.2 (D:119-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3arfd2:

Click to download the PDB-style file with coordinates for d3arfd2.
(The format of our PDB-style files is described here.)

Timeline for d3arfd2: