Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d3arfc2: 3arf C:118-207 [198921] Other proteins in same PDB: d3arfa1, d3arfa2, d3arfa3, d3arfb_, d3arfc1, d3arfd1 automated match to d1qrnd2 complexed with db3 |
PDB Entry: 3arf (more details), 2.9 Å
SCOPe Domain Sequences for d3arfc2:
Sequence, based on SEQRES records: (download)
>d3arfc2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
>d3arfc2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnkdfacanafnnsiipedtffpsp
Timeline for d3arfc2: