Lineage for d3arfc1 (3arf C:1-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371095Domain d3arfc1: 3arf C:1-117 [198920]
    Other proteins in same PDB: d3arfa1, d3arfa2, d3arfa3, d3arfb_, d3arfc2, d3arfd2
    automated match to d1qrnd1
    complexed with db3

Details for d3arfc1

PDB Entry: 3arf (more details), 2.9 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
PDB Compounds: (C:) NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3arfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arfc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d3arfc1:

Click to download the PDB-style file with coordinates for d3arfc1.
(The format of our PDB-style files is described here.)

Timeline for d3arfc1: