Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88616] (9 PDB entries) |
Domain d3arfa2: 3arf A:186-300 [198919] Other proteins in same PDB: d3arfa1, d3arfb_, d3arfc1, d3arfc2, d3arfd1, d3arfd2 automated match to d1gzqa1 complexed with db3 |
PDB Entry: 3arf (more details), 2.9 Å
SCOPe Domain Sequences for d3arfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arfa2 b.1.1.2 (A:186-300) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilywgslhhildaqkmvwnhrhhhh
Timeline for d3arfa2: