Lineage for d3arfa2 (3arf A:186-300)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514356Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1514384Species Mouse (Mus musculus) [TaxId:10090] [88616] (9 PDB entries)
  8. 1514396Domain d3arfa2: 3arf A:186-300 [198919]
    Other proteins in same PDB: d3arfa1, d3arfb_, d3arfc1, d3arfc2, d3arfd1, d3arfd2
    automated match to d1gzqa1
    complexed with db3

Details for d3arfa2

PDB Entry: 3arf (more details), 2.9 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3arfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arfa2 b.1.1.2 (A:186-300) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilywgslhhildaqkmvwnhrhhhh

SCOPe Domain Coordinates for d3arfa2:

Click to download the PDB-style file with coordinates for d3arfa2.
(The format of our PDB-style files is described here.)

Timeline for d3arfa2: