Lineage for d3arfa1 (3arf A:7-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182598Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2182641Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2182663Domain d3arfa1: 3arf A:7-185 [198918]
    Other proteins in same PDB: d3arfa2, d3arfa3, d3arfb_, d3arfc1, d3arfc2, d3arfd1, d3arfd2
    automated match to d1gzpa2
    complexed with db3

Details for d3arfa1

PDB Entry: 3arf (more details), 2.9 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3arfa1:

Sequence, based on SEQRES records: (download)

>d3arfa1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3arfa1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemygnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3arfa1:

Click to download the PDB-style file with coordinates for d3arfa1.
(The format of our PDB-style files is described here.)

Timeline for d3arfa1: