SCOPe 2.07: Domain d3ared2: 3are D:119-247

Lineage for d3ared2 (3are D:119-247)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d3ared2: 3are D:119-247 [198917]
   Other proteins in same PDB: d3area1, d3area2, d3area3, d3areb_, d3arec1, d3ared1
   automated match to d1ktke2
   complexed with 4gh, nag, peg

Details for d3ared2

PDB Entry: 3are, 2.8 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide

PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3ared2:

Sequence; same for both SEQRES and ATOM records:

>d3ared2 b.1.1.2 (D:119-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3ared2:

• d3ared2 first appeared in SCOPe 2.03
  
• d3ared2 appears in SCOPe 2.06
  
• d3ared2 appears in the current release, SCOPe 2.08