Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d3ared2: 3are D:119-247 [198917] Other proteins in same PDB: d3area1, d3area2, d3area3, d3areb_, d3arec1, d3ared1 automated match to d1ktke2 complexed with 4gh, nag, peg |
PDB Entry: 3are (more details), 2.8 Å
SCOPe Domain Sequences for d3ared2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ared2 b.1.1.2 (D:119-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d3ared2: