Lineage for d3area2 (3are A:186-279)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026128Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2026160Species Mouse (Mus musculus) [TaxId:10090] [88616] (9 PDB entries)
  8. 2026171Domain d3area2: 3are A:186-279 [198913]
    Other proteins in same PDB: d3area1, d3area3, d3areb_, d3arec1, d3arec2, d3ared1, d3ared2
    automated match to d1gzqa1
    complexed with 4gh, nag, peg

Details for d3area2

PDB Entry: 3are (more details), 2.8 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3area2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3area2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3area2:

Click to download the PDB-style file with coordinates for d3area2.
(The format of our PDB-style files is described here.)

Timeline for d3area2: