SCOP 1.65: Domain d1mfbh1: 1mfb H:251-367

Lineage for d1mfbh1 (1mfb H:251-367)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1mfbh1: 1mfb H:251-367 [19891]
   Other proteins in same PDB: d1mfbh2, d1mfbl1, d1mfbl2
   part of Fab SE155-4
   complexed with abe, gal, man, ram

Details for d1mfbh1

PDB Entry: 1mfb, 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfbh1:

Sequence; same for both SEQRES and ATOM records:

>d1mfbh1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

Timeline for d1mfbh1:

• d1mfbh1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfbh1 appears in SCOP 1.63
  
• d1mfbh1 appears in SCOP 1.67
  
• d1mfbh1 appears in the current release, SCOPe 2.08