Lineage for d1mfbh1 (1mfb H:251-367)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158371Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)
  8. 158374Domain d1mfbh1: 1mfb H:251-367 [19891]
    Other proteins in same PDB: d1mfbh2, d1mfbl2

Details for d1mfbh1

PDB Entry: 1mfb (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfbh1 b.1.1.1 (H:251-367) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

SCOP Domain Coordinates for d1mfbh1:

Click to download the PDB-style file with coordinates for d1mfbh1.
(The format of our PDB-style files is described here.)

Timeline for d1mfbh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfbh2