![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries) |
![]() | Domain d1mfbh1: 1mfb H:251-367 [19891] Other proteins in same PDB: d1mfbh2, d1mfbl2 |
PDB Entry: 1mfb (more details), 2.1 Å
SCOP Domain Sequences for d1mfbh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfbh1 b.1.1.1 (H:251-367) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain} evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs
Timeline for d1mfbh1: