Lineage for d3arbc2 (3arb C:118-207)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031151Domain d3arbc2: 3arb C:118-207 [198907]
    Other proteins in same PDB: d3arba1, d3arba2, d3arba3, d3arbb_, d3arbc1, d3arbd1
    automated match to d1qrnd2
    complexed with d12, fee, nag, peg

Details for d3arbc2

PDB Entry: 3arb (more details), 2.7 Å

PDB Description: ternary crystal structure of the nkt tcr-cd1d-alpha-galactosylceramide analogue-och
PDB Compounds: (C:) NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3arbc2:

Sequence, based on SEQRES records: (download)

>d3arbc2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d3arbc2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d3arbc2:

Click to download the PDB-style file with coordinates for d3arbc2.
(The format of our PDB-style files is described here.)

Timeline for d3arbc2: