Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Cucumaria echinata [TaxId:40245] [189610] (3 PDB entries) |
Domain d3altc_: 3alt C: [198902] automated match to d3alud_ complexed with ca |
PDB Entry: 3alt (more details), 2.5 Å
SCOPe Domain Sequences for d3altc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3altc_ d.169.1.0 (C:) automated matches {Cucumaria echinata [TaxId: 40245]} ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr gaiaagdysrgfwadvysnnnfkyicqlpcvhytle
Timeline for d3altc_: