Lineage for d3altb_ (3alt B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443254Species Cucumaria echinata [TaxId:40245] [189610] (2 PDB entries)
  8. 1443260Domain d3altb_: 3alt B: [198901]
    automated match to d3alud_
    complexed with ca, mlb

Details for d3altb_

PDB Entry: 3alt (more details), 2.5 Å

PDB Description: crystal structure of cel-iv complexed with melibiose
PDB Compounds: (B:) Lectin CEL-IV, C-type

SCOPe Domain Sequences for d3altb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3altb_ d.169.1.0 (B:) automated matches {Cucumaria echinata [TaxId: 40245]}
ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
gaiaagdysrgfwadvysnnnfkyicqlpcvhytle

SCOPe Domain Coordinates for d3altb_:

Click to download the PDB-style file with coordinates for d3altb_.
(The format of our PDB-style files is described here.)

Timeline for d3altb_: