Lineage for d1mfbl1 (1mfb L:1-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653767Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 653854Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)
  8. 653860Domain d1mfbl1: 1mfb L:1-111 [19890]
    Other proteins in same PDB: d1mfbh1, d1mfbh2, d1mfbl2
    part of Fab SE155-4
    complexed with abe, gal, man, ram

Details for d1mfbl1

PDB Entry: 1mfb (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella
PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOP Domain Sequences for d1mfbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfbl1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

SCOP Domain Coordinates for d1mfbl1:

Click to download the PDB-style file with coordinates for d1mfbl1.
(The format of our PDB-style files is described here.)

Timeline for d1mfbl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfbl2