Lineage for d1mfah1 (1mfa H:251-367)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022086Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2022093Domain d1mfah1: 1mfa H:251-367 [19889]
    Other proteins in same PDB: d1mfal1
    part of Fv SE155-4

Details for d1mfah1

PDB Entry: 1mfa (more details), 1.7 Å

PDB Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution
PDB Compounds: (H:) igg1-lambda se155-4 fab (heavy chain)

SCOPe Domain Sequences for d1mfah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvs

SCOPe Domain Coordinates for d1mfah1:

Click to download the PDB-style file with coordinates for d1mfah1.
(The format of our PDB-style files is described here.)

Timeline for d1mfah1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mfal1