Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (22 species) not a true protein |
Species Salmonella enterica [TaxId:439842] [189595] (2 PDB entries) |
Domain d3ak9d_: 3ak9 D: [198889] automated match to d3ak8i_ complexed with fe2, mg, so4 |
PDB Entry: 3ak9 (more details), 1.3 Å
SCOPe Domain Sequences for d3ak9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ak9d_ a.25.1.1 (D:) automated matches {Salmonella enterica [TaxId: 439842]} llytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal tdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandvr kaigeakdedtadiftaasrdldkflwfiesnie
Timeline for d3ak9d_: