SCOP 1.69: Domain d1mfa_1: 1mfa 1L-111L

Lineage for d1mfa_1 (1mfa 1L-111L)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)

8. Domain d1mfa_1: 1mfa 1L-111L [19888]
   Other proteins in same PDB: d1mfa_2
   part of Fv SE155-4

Details for d1mfa_1

PDB Entry: 1mfa, 1.7 Å

PDB Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution

SCOP Domain Sequences for d1mfa_1:

Sequence; same for both SEQRES and ATOM records:

>d1mfa_1 b.1.1.1 (1L-111L) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
qivvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwsnnhwifgggtkltvlgq

Timeline for d1mfa_1:

• d1mfa_1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfa_1 appears in SCOP 1.67
  
• d1mfa_1 appears in SCOP 1.71
  
• d1mfa_1 appears in the current release, SCOPe 2.08, called d1mfal1