Lineage for d3ag2o1 (3ag2 O:1-90)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024057Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 3024058Species Cow (Bos taurus) [TaxId:9913] [81454] (50 PDB entries)
  8. 3024072Domain d3ag2o1: 3ag2 O:1-90 [198860]
    Other proteins in same PDB: d3ag2a_, d3ag2b2, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_
    automated match to d1v54b2
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d3ag2o1

PDB Entry: 3ag2 (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3ag2o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag2o1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d3ag2o1:

Click to download the PDB-style file with coordinates for d3ag2o1.
(The format of our PDB-style files is described here.)

Timeline for d3ag2o1: