Lineage for d3ag1o1 (3ag1 O:1-90)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456154Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1456176Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1456177Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1456219Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1456220Species Cow (Bos taurus) [TaxId:9913] [81454] (24 PDB entries)
  8. 1456246Domain d3ag1o1: 3ag1 O:1-90 [198856]
    Other proteins in same PDB: d3ag1a_, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_
    automated match to d1v54b2
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1o1

PDB Entry: 3ag1 (more details), 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3ag1o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag1o1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d3ag1o1:

Click to download the PDB-style file with coordinates for d3ag1o1.
(The format of our PDB-style files is described here.)

Timeline for d3ag1o1: