![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81454] (26 PDB entries) |
![]() | Domain d3abmo1: 3abm O:1-90 [198850] Other proteins in same PDB: d3abma_, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ automated match to d1v54b2 complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abm (more details), 1.95 Å
SCOPe Domain Sequences for d3abmo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abmo1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d3abmo1:
![]() Domains from other chains: (mouse over for more information) d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ |