SCOPe 2.03: Domain d3ablo2: 3abl O:91-227

Lineage for d3ablo2 (3abl O:91-227)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (24 PDB entries)

8. Domain d3ablo2: 3abl O:91-227 [198847]
   Other proteins in same PDB: d3abla_, d3ablb1, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_
   automated match to d1v54b1
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3ablo2

PDB Entry: 3abl, 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3ablo2:

Sequence; same for both SEQRES and ATOM records:

>d3ablo2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d3ablo2:

• d3ablo2 is new in SCOPe 2.03-stable
  
• d3ablo2 appears in SCOPe 2.04
  
• d3ablo2 appears in the current release, SCOPe 2.08