SCOP 1.73: Domain d1acyl1: 1acy L:1-108

Lineage for d1acyl1 (1acy L:1-108)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)

8. Domain d1acyl1: 1acy L:1-108 [19884]
   Other proteins in same PDB: d1acyh1, d1acyh2, d1acyl2
   part of Fab 59.1

Details for d1acyl1

PDB Entry: 1acy, 3 Å

PDB Description: crystal structure of the principal neutralizing site of hiv-1

PDB Compounds: (L:) igg1-kappa 59.1 fab (light chain)

SCOP Domain Sequences for d1acyl1:

Sequence; same for both SEQRES and ATOM records:

>d1acyl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divmtqspaslvvslgqratiscrasesvdsygksfmhwyqqkpgqppkvliyiasnles
gvparfsgsgsrtdftltidpveaddaatyycqqnnedpptfgagtklemrr

Timeline for d1acyl1:

• d1acyl1 first appeared (with stable ids) in SCOP 1.55
  
• d1acyl1 appears in SCOP 1.71
  
• d1acyl1 appears in SCOP 1.75
  
• d1acyl1 appears in the current release, SCOPe 2.08