Lineage for d2zzul2 (2zzu L:49-86)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2635903Protein Coagulation factor VIIa [57201] (1 species)
  7. 2635904Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2635970Domain d2zzul2: 2zzu L:49-86 [198822]
    Other proteins in same PDB: d2zzuh_, d2zzul1
    automated match to d1danl1
    complexed with 359, bgc, ca, fuc

Details for d2zzul2

PDB Entry: 2zzu (more details), 2.5 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d-5- (3-carboxybenzyloxy)-trp-gln-p-aminobenzamidine
PDB Compounds: (L:) Factor VII light chain

SCOPe Domain Sequences for d2zzul2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zzul2 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2zzul2:

Click to download the PDB-style file with coordinates for d2zzul2.
(The format of our PDB-style files is described here.)

Timeline for d2zzul2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zzuh_