Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries) |
Domain d2zxwb2: 2zxw B:91-227 [198818] Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_ automated match to d1v54b1 complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 2zxw (more details), 2.5 Å
SCOPe Domain Sequences for d2zxwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxwb2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv lelvplkyfekwsasml
Timeline for d2zxwb2:
View in 3D Domains from other chains: (mouse over for more information) d2zxwa_, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_ |