SCOPe 2.03: Domain d2zwll3: 2zwl L:87-142

Lineage for d2zwll3 (2zwl L:87-142)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (43 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d2zwll3: 2zwl L:87-142 [198816]
   Other proteins in same PDB: d2zwlh_, d2zwll1
   automated match to d1danl2
   complexed with 567, bgc, ca, fuc

Details for d2zwll3

PDB Entry: 2zwl, 2.2 Å

PDB Description: human factor viia-tissue factor complexed with highly selective peptide inhibitor

PDB Compounds: (L:) Factor VII light chain

SCOPe Domain Sequences for d2zwll3:

Sequence; same for both SEQRES and ATOM records:

>d2zwll3 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d2zwll3:

• d2zwll3 is new in SCOPe 2.03-stable
  
• d2zwll3 appears in SCOPe 2.04
  
• d2zwll3 appears in the current release, SCOPe 2.08