![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
![]() | Domain d2zwll3: 2zwl L:87-142 [198816] Other proteins in same PDB: d2zwlh_, d2zwll1 automated match to d1danl2 complexed with 567, bgc, ca, fuc |
PDB Entry: 2zwl (more details), 2.2 Å
SCOPe Domain Sequences for d2zwll3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwll3 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d2zwll3: