SCOPe 2.06: Domain d2zd1a2: 2zd1 A:430-552

Lineage for d2zd1a2 (2zd1 A:430-552)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)

8. Domain d2zd1a2: 2zd1 A:430-552 [198799]
   Other proteins in same PDB: d2zd1a1, d2zd1a3, d2zd1b_
   automated match to d1bqna1
   protein/DNA complex; protein/RNA complex; complexed with edo, so4, t27

Details for d2zd1a2

PDB Entry: 2zd1, 1.8 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2zd1a2:

Sequence; same for both SEQRES and ATOM records:

>d2zd1a2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d2zd1a2:

• d2zd1a2 first appeared in SCOPe 2.03
  
• d2zd1a2 appears in SCOPe 2.05
  
• d2zd1a2 appears in SCOPe 2.07
  
• d2zd1a2 appears in the current release, SCOPe 2.08